SCOPe 2.08: Domain d1enha_: 1enh A:

Lineage for d1enha_ (1enh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Engrailed Homeodomain [46691] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)

8. Domain d1enha_: 1enh A: [15973]

Details for d1enha_

PDB Entry: 1enh, 2.1 Å

PDB Description: structural studies of the engrailed homeodomain

PDB Compounds: (A:) engrailed homeodomain

SCOPe Domain Sequences for d1enha_:

Sequence; same for both SEQRES and ATOM records:

>d1enha_ a.4.1.1 (A:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki

Timeline for d1enha_:

• d1enha_ first appeared (with stable ids) in SCOP 1.55, called d1enh__
  
• d1enha_ appears in SCOPe 2.07