![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Engrailed Homeodomain [46691] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries) |
![]() | Domain d1enha_: 1enh A: [15973] |
PDB Entry: 1enh (more details), 2.1 Å
SCOPe Domain Sequences for d1enha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enha_ a.4.1.1 (A:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki
Timeline for d1enha_: