Lineage for d1enh__ (1enh -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1234Protein Engrailed Homeodomain [46691] (1 species)
  7. 1235Species Drosophila melanogaster [TaxId:7227] [46692] (5 PDB entries)
  8. 1238Domain d1enh__: 1enh - [15973]

Details for d1enh__

PDB Entry: 1enh (more details), 2.1 Å

PDB Description: structural studies of the engrailed homeodomain

SCOP Domain Sequences for d1enh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enh__ a.4.1.1 (-) Engrailed Homeodomain {Drosophila melanogaster}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki

SCOP Domain Coordinates for d1enh__:

Click to download the PDB-style file with coordinates for d1enh__.
(The format of our PDB-style files is described here.)

Timeline for d1enh__: