Lineage for d1enha_ (1enh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305224Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2305236Protein Engrailed Homeodomain [46691] (1 species)
  7. 2305237Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 2305248Domain d1enha_: 1enh A: [15973]

Details for d1enha_

PDB Entry: 1enh (more details), 2.1 Å

PDB Description: structural studies of the engrailed homeodomain
PDB Compounds: (A:) engrailed homeodomain

SCOPe Domain Sequences for d1enha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enha_ a.4.1.1 (A:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki

SCOPe Domain Coordinates for d1enha_:

Click to download the PDB-style file with coordinates for d1enha_.
(The format of our PDB-style files is described here.)

Timeline for d1enha_: