Lineage for d3cc4z1 (3cc4 Z:35-106)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2588084Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2588085Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 2588086Protein Ribosomal protein L37ae [57831] (1 species)
  7. 2588087Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 2588125Domain d3cc4z1: 3cc4 Z:35-106 [156219]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1
    automatically matched to d1s72z_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4z1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3cc4z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4z1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3cc4z1:

Click to download the PDB-style file with coordinates for d3cc4z1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4z1: