Lineage for d3cc4u1 (3cc4 U:4-56)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3043923Domain d3cc4u1: 3cc4 U:4-56 [156214]
    Other proteins in same PDB: d3cc421, d3cc4b1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4p1, d3cc4r1, d3cc4s1, d3cc4y1, d3cc4z1
    automatically matched to d1w2bt_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4u1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d3cc4u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4u1 i.1.1.2 (U:4-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d3cc4u1:

Click to download the PDB-style file with coordinates for d3cc4u1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4u1: