Lineage for d3cc4s1 (3cc4 S:1-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929542Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2929543Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2929544Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2929545Protein Ribosomal protein L23 [54191] (4 species)
  7. 2929584Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 2929618Domain d3cc4s1: 3cc4 S:1-81 [156212]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
    automatically matched to d1jj2r_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4s1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3cc4s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4s1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d3cc4s1:

Click to download the PDB-style file with coordinates for d3cc4s1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4s1: