SCOPe 2.08: Domain d3cc421: 3cc4 2:1-49

Lineage for d3cc421 (3cc4 2:1-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d3cc421: 3cc4 2:1-49 [156197]
   Other proteins in same PDB: d3cc411, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
   automatically matched to 1VQ4 2:1-49
   complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc421

PDB Entry: 3cc4, 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit

PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3cc421:

Sequence, based on SEQRES records:

>d3cc421 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d3cc421 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d3cc421:

• d3cc421 first appeared in SCOP 1.75
  
• d3cc421 appears in SCOPe 2.07