Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cc4o1: 3cc4 O:1-115 [156208] Other proteins in same PDB: d3cc421, d3cc4b1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4p1, d3cc4r1, d3cc4s1, d3cc4y1, d3cc4z1 automatically matched to d1w2bn_ complexed with anm, cd, cl, k, mg, na, sr |
PDB Entry: 3cc4 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc4o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc4o1 i.1.1.2 (O:1-115) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d3cc4o1: