![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
![]() | Protein Bacteriophytochrome BphP [160672] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries) Uniprot Q9HWR3 5-117 |
![]() | Domain d3c2wg3: 3c2w G:5-117 [155907] Other proteins in same PDB: d3c2wa1, d3c2wa2, d3c2wb1, d3c2wb2, d3c2wc1, d3c2wc2, d3c2wd1, d3c2wd2, d3c2we1, d3c2we2, d3c2wf1, d3c2wf2, d3c2wf4, d3c2wg1, d3c2wg2, d3c2wh1, d3c2wh2 automated match to d3c2wa3 complexed with bla |
PDB Entry: 3c2w (more details), 2.9 Å
SCOPe Domain Sequences for d3c2wg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2wg3 d.110.3.9 (G:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt
Timeline for d3c2wg3: