Lineage for d3c2wa3 (3c2w A:5-117)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577150Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 2577151Protein Bacteriophytochrome BphP [160672] (3 species)
  7. 2577158Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
    Uniprot Q9HWR3 5-117
  8. 2577167Domain d3c2wa3: 3c2w A:5-117 [155889]
    Other proteins in same PDB: d3c2wa1, d3c2wa2, d3c2wb1, d3c2wb2, d3c2wc1, d3c2wc2, d3c2wd1, d3c2wd2, d3c2we1, d3c2we2, d3c2wf1, d3c2wf2, d3c2wf4, d3c2wg1, d3c2wg2, d3c2wh1, d3c2wh2
    complexed with bla

Details for d3c2wa3

PDB Entry: 3c2w (more details), 2.9 Å

PDB Description: Crystal structure of the photosensory core domain of P. aeruginosa bacteriophytochrome PaBphP in the Pfr state
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3c2wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2wa3 d.110.3.9 (A:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

SCOPe Domain Coordinates for d3c2wa3:

Click to download the PDB-style file with coordinates for d3c2wa3.
(The format of our PDB-style files is described here.)

Timeline for d3c2wa3: