SCOPe 2.07: Domain d3c2wb3: 3c2w B:5-117

Lineage for d3c2wb3 (3c2w B:5-117)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
   Pfam PF08446; PAS_2

6. Protein Bacteriophytochrome BphP [160672] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
   Uniprot Q9HWR3 5-117

8. Domain d3c2wb3: 3c2w B:5-117 [155892]
   Other proteins in same PDB: d3c2wa1, d3c2wa2, d3c2wb1, d3c2wb2, d3c2wc1, d3c2wc2, d3c2wd1, d3c2wd2, d3c2we1, d3c2we2, d3c2wf1, d3c2wf2, d3c2wf4, d3c2wg1, d3c2wg2, d3c2wh1, d3c2wh2
   automated match to d3c2wa3
   complexed with bla

Details for d3c2wb3

PDB Entry: 3c2w, 2.9 Å

PDB Description: Crystal structure of the photosensory core domain of P. aeruginosa bacteriophytochrome PaBphP in the Pfr state

PDB Compounds: (B:) Bacteriophytochrome

SCOPe Domain Sequences for d3c2wb3:

Sequence; same for both SEQRES and ATOM records:

>d3c2wb3 d.110.3.9 (B:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

Timeline for d3c2wb3:

• d3c2wb3 first appeared in SCOP 1.75
  
• d3c2wb3 appears in SCOPe 2.06
  
• d3c2wb3 appears in the current release, SCOPe 2.08