SCOPe 2.07: Structural Classification of Proteins

PDB entry 3c2w

View 3c2w on RCSB PDB site
Description: Crystal structure of the photosensory core domain of P. aeruginosa bacteriophytochrome PaBphP in the Pfr state
Class: signaling protein
Keywords: Knot structure, Chromophore, Kinase, Phosphoprotein, Photoreceptor protein, Receptor, Sensory transduction, Transferase, SIGNALING PROTEIN
Deposited on 2008-01-25, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.07: d3c2wa1, d3c2wa2, d3c2wa3
Chain 'B':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3 (Start-496)
Domains in SCOPe 2.07: d3c2wb1, d3c2wb2, d3c2wb3
Chain 'C':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.07: d3c2wc1, d3c2wc2, d3c2wc3
Chain 'D':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.07: d3c2wd1, d3c2wd2, d3c2wd3
Chain 'E':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.07: d3c2we1, d3c2we2, d3c2we3
Chain 'F':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3 (Start-496)
  - expression tag (497)
Domains in SCOPe 2.07: d3c2wf1, d3c2wf2, d3c2wf3, d3c2wf4
Chain 'G':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3 (Start-496)
Domains in SCOPe 2.07: d3c2wg1, d3c2wg2, d3c2wg3
Chain 'H':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.07: d3c2wh1, d3c2wh2, d3c2wh3
Heterogens: BLA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3c2wA (A:)
mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
iaeklrldlmelclnhalehhhhhh