Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein Bacteriophytochrome BphP [160661] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [160662] (5 PDB entries) Uniprot Q9HWR3 118-309 |
Domain d3c2wb1: 3c2w B:118-309 [155890] Other proteins in same PDB: d3c2wa2, d3c2wa3, d3c2wb2, d3c2wb3, d3c2wc2, d3c2wc3, d3c2wd2, d3c2wd3, d3c2we2, d3c2we3, d3c2wf2, d3c2wf3, d3c2wf4, d3c2wg2, d3c2wg3, d3c2wh2, d3c2wh3 automated match to d3c2wa1 complexed with bla |
PDB Entry: 3c2w (more details), 2.9 Å
SCOPe Domain Sequences for d3c2wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2wb1 d.110.2.1 (B:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes rredlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq vcsaiverleqg
Timeline for d3c2wb1: