Lineage for d3c2wg3 (3c2w G:5-117)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970589Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 2970590Protein Bacteriophytochrome BphP [160672] (3 species)
  7. 2970597Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
    Uniprot Q9HWR3 5-117
  8. 2970612Domain d3c2wg3: 3c2w G:5-117 [155907]
    Other proteins in same PDB: d3c2wa1, d3c2wa2, d3c2wb1, d3c2wb2, d3c2wc1, d3c2wc2, d3c2wd1, d3c2wd2, d3c2we1, d3c2we2, d3c2wf1, d3c2wf2, d3c2wf4, d3c2wg1, d3c2wg2, d3c2wh1, d3c2wh2
    automated match to d3c2wa3
    complexed with bla

Details for d3c2wg3

PDB Entry: 3c2w (more details), 2.9 Å

PDB Description: Crystal structure of the photosensory core domain of P. aeruginosa bacteriophytochrome PaBphP in the Pfr state
PDB Compounds: (G:) Bacteriophytochrome

SCOPe Domain Sequences for d3c2wg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2wg3 d.110.3.9 (G:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

SCOPe Domain Coordinates for d3c2wg3:

Click to download the PDB-style file with coordinates for d3c2wg3.
(The format of our PDB-style files is described here.)

Timeline for d3c2wg3: