| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
| Domain d3c1bf_: 3c1b F: [155856] Other proteins in same PDB: d3c1ba_, d3c1bc_, d3c1bd_, d3c1be_, d3c1bg_, d3c1bh_ automated match to d1eqzd_ protein/DNA complex |
PDB Entry: 3c1b (more details), 2.2 Å
SCOPe Domain Sequences for d3c1bf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1bf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
krhrxvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
akrktvtamdvvyalkrqgrtlygfgg
Timeline for d3c1bf_: