PDB entry 3c1b

View 3c1b on RCSB PDB site
Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
Class: Structural PROTEIN/DNA
Keywords: Nucleosome, Dimethylated histone, trimethylated histone, methylation, nucleosomal surface, histone modification, nucleosomal array, chromatin, Acetylation, Chromosomal protein, DNA-binding, Nucleosome core, Nucleus, Phosphoprotein, Ubl conjugation, Structural PROTEIN/DNA COMPLEX
Deposited on 2008-01-22, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3-like
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02302
      • conflict (85)
    Domains in SCOPe 2.07: d3c1ba_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1bb_
  • Chain 'C':
    Compound: Histone H2A type 1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
    Domains in SCOPe 2.07: d3c1bc_
  • Chain 'D':
    Compound: Histone 2, H2bf
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: hist2h2bf, TGas058p09.1-001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1bd_
  • Chain 'E':
    Compound: Histone H3-like
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02302 (Start-134)
      • conflict (85)
    Domains in SCOPe 2.07: d3c1be_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1bf_
  • Chain 'G':
    Compound: Histone H2A type 1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
    Domains in SCOPe 2.07: d3c1bg_
  • Chain 'H':
    Compound: Histone 2, H2bf
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: hist2h2bf, TGas058p09.1-001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1bh_
  • Chain 'I':
    Compound: Palindromic 146bp Human Alpha satellite DNA
  • Chain 'J':
    Compound: Palindromic 146bp Human Alpha satellite DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1bA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c1bB (B:)
    sgrgkggkglgkggakrhrxvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bB (B:)
    rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
    amdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c1bC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esskstksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bC (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c1bD (D:)
    pdpaksapaakkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bD (D:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3c1bE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bE (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3c1bF (F:)
    sgrgkggkglgkggakrhrxvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bF (F:)
    krhrxvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3c1bG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esskstksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bG (G:)
    trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
    triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3c1bH (H:)
    pdpaksapaakkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1bH (H:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.