Lineage for d3c1bb_ (3c1b B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698447Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 2698455Domain d3c1bb_: 3c1b B: [155852]
    Other proteins in same PDB: d3c1ba_, d3c1bc_, d3c1bd_, d3c1be_, d3c1bg_, d3c1bh_
    automated match to d1eqzd_
    protein/DNA complex

Details for d3c1bb_

PDB Entry: 3c1b (more details), 2.2 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3c1bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1bb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d3c1bb_:

Click to download the PDB-style file with coordinates for d3c1bb_.
(The format of our PDB-style files is described here.)

Timeline for d3c1bb_: