| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries) Uniprot P62801 |
| Domain d1eqzd_: 1eqz D: [16466] Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzc_, d1eqze_, d1eqzf_, d1eqzg_ protein/DNA complex; complexed with cac, cl, k, mn |
PDB Entry: 1eqz (more details), 2.5 Å
SCOPe Domain Sequences for d1eqzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqzd_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
gakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyt
ehakrktvtamdvvyalkrqgrtlygfgg
Timeline for d1eqzd_: