SCOP 1.75: Domain d2vhos1: 2vho S:2-80

Lineage for d2vhos1 (2vho S:2-80)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
   Uniprot P0A7U3 2-80

8. Domain d2vhos1: 2vho S:2-80 [153141]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhot1, d2vhou1
   automatically matched to 2AVY S:2-80
   complexed with mg

Details for d2vhos1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d2vhos1:

Sequence; same for both SEQRES and ATOM records:

>d2vhos1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

Timeline for d2vhos1:

• d2vhos1 is new in SCOP 1.75
  
• d2vhos1 appears in SCOPe 2.01
  
• d2vhos1 appears in the current release, SCOPe 2.08