| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
| Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
| Protein Ribosomal protein S2 [52315] (3 species) |
| Species Escherichia coli [TaxId:562] [159491] (26 PDB entries) Uniprot P0A7V0 8-225 |
| Domain d2vhob1: 2vho B:8-225 [153122] Other proteins in same PDB: d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1 automatically matched to 2AVY B:8-225 complexed with mg |
PDB Entry: 2vho (more details), 3.74 Å
SCOP Domain Sequences for d2vhob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhob1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs
Timeline for d2vhob1: