Lineage for d2vhos1 (2vho S:2-80)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942145Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2942146Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2942147Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2942148Protein Ribosomal protein S19 [54572] (2 species)
  7. 2942149Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 2942166Domain d2vhos1: 2vho S:2-80 [153141]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhot1, d2vhou1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhos1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2vhos1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhos1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2vhos1:

Click to download the PDB-style file with coordinates for d2vhos1.
(The format of our PDB-style files is described here.)

Timeline for d2vhos1: