SCOP 1.75: Domain d2vhoe1: 2vho E:78-158

Lineage for d2vhoe1 (2vho E:78-158)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d2vhoe1: 2vho E:78-158 [153126]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   automatically matched to 2AVY E:78-158
   complexed with mg

Details for d2vhoe1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2vhoe1:

Sequence; same for both SEQRES and ATOM records:

>d2vhoe1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d2vhoe1:

• d2vhoe1 is new in SCOP 1.75
  
• d2vhoe1 appears in SCOPe 2.01
  
• d2vhoe1 appears in the current release, SCOPe 2.08