SCOP 1.75: Domain d2vhol1: 2vho L:1-123

Lineage for d2vhol1 (2vho L:1-123)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (2 species)

7. Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
   Uniprot P0A7S3 1-123

8. Domain d2vhol1: 2vho L:1-123 [153134]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   automatically matched to 2AVY L:1-123
   complexed with mg

Details for d2vhol1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (L:) 30S ribosomal protein S12

SCOP Domain Sequences for d2vhol1:

Sequence; same for both SEQRES and ATOM records:

>d2vhol1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

Timeline for d2vhol1:

• d2vhol1 is new in SCOP 1.75
  
• d2vhol1 appears in SCOPe 2.01
  
• d2vhol1 appears in the current release, SCOPe 2.08