| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
| Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
| Protein Ribosomal protein S15 [47065] (3 species) |
| Species Escherichia coli [TaxId:562] [158383] (10 PDB entries) Uniprot Q8X9M2 2-89 |
| Domain d2vhoo1: 2vho O:1-88 [153137] Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1 automatically matched to 2AVY O:1-88 complexed with mg |
PDB Entry: 2vho (more details), 3.74 Å
SCOP Domain Sequences for d2vhoo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhoo1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr
Timeline for d2vhoo1: