SCOP 1.75: Domain d2vhoh1: 2vho H:2-128

Lineage for d2vhoh1 (2vho H:2-128)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d2vhoh1: 2vho H:2-128 [153130]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   automatically matched to d1p6gh_
   complexed with mg

Details for d2vhoh1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2vhoh1:

Sequence; same for both SEQRES and ATOM records:

>d2vhoh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

Timeline for d2vhoh1:

• d2vhoh1 is new in SCOP 1.75
  
• d2vhoh1 appears in SCOPe 2.01
  
• d2vhoh1 appears in the current release, SCOPe 2.08