SCOPe 2.08: Domain d2vhmc2: 2vhm C:61-124

Lineage for d2vhmc2 (2vhm C:61-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2vhmc2: 2vhm C:61-124 [153063]
   Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d2vhmc2

PDB Entry: 2vhm, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2vhmc2:

Sequence; same for both SEQRES and ATOM records:

>d2vhmc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2vhmc2:

• d2vhmc2 first appeared in SCOP 1.75
  
• d2vhmc2 appears in SCOPe 2.07