Lineage for d2vhmg1 (2vhm G:1-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978336Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2978337Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2978338Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2978339Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2978356Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 2978397Domain d2vhmg1: 2vhm G:1-81 [153067]
    Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhmg1

PDB Entry: 2vhm (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2vhmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhmg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOPe Domain Coordinates for d2vhmg1:

Click to download the PDB-style file with coordinates for d2vhmg1.
(The format of our PDB-style files is described here.)

Timeline for d2vhmg1: