Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.325: L28p-like [143799] (1 superfamily) unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715) |
Superfamily d.325.1: L28p-like [143800] (2 families) In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known |
Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein) Pfam PF01197 |
Protein Ribosomal protein L31p [143805] (2 species) |
Species Escherichia coli [TaxId:562] [143806] (9 PDB entries) Uniprot P0A7M9 1-70 |
Domain d2vhmz1: 2vhm Z:1-70 [153089] Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhm (more details), 3.74 Å
SCOPe Domain Sequences for d2vhmz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhmz1 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia coli [TaxId: 562]} mkkdihpkyeeitascscgnvmkirstvghdlnldvcskchpfftgkqrdvatggrvdrf nkrfnipgsk
Timeline for d2vhmz1:
View in 3D Domains from other chains: (mouse over for more information) d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1 |