Class a: All alpha proteins [46456] (290 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) automatically mapped to Pfam PF00453 |
Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
Protein Ribosomal protein L20 [74733] (4 species) |
Species Escherichia coli [TaxId:562] [158511] (29 PDB entries) Uniprot P0A7L3 1-117 |
Domain d2vhmq1: 2vhm Q:1-117 [153080] Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhm (more details), 3.74 Å
SCOPe Domain Sequences for d2vhmq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhmq1 a.144.2.1 (Q:1-117) Ribosomal protein L20 {Escherichia coli [TaxId: 562]} arvkrgviararhkkilkqakgyygarsrvyrvafqavikagqyayrdrrqrkrqfrqlw iarinaaarqngisyskfinglkkasveidrkiladiavfdkvaftalvekakaala
Timeline for d2vhmq1:
View in 3D Domains from other chains: (mouse over for more information) d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1 |