Lineage for d2vhmh2 (2vhm H:1-58)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967247Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2967248Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2967249Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2967250Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2967258Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2967279Domain d2vhmh2: 2vhm H:1-58 [153070]
    Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhmh2

PDB Entry: 2vhm (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2vhmh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhmh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2vhmh2:

Click to download the PDB-style file with coordinates for d2vhmh2.
(The format of our PDB-style files is described here.)

Timeline for d2vhmh2: