Lineage for d2rgna2 (2rgn A:38-66,A:184-354)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867892Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2867934Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries)
    Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372
  8. 2867941Domain d2rgna2: 2rgn A:38-66,A:184-354 [152013]
    Other proteins in same PDB: d2rgna1, d2rgnc1, d2rgnd1, d2rgnf1
    automatically matched to d2bcjq2
    complexed with alf, gdp, mg

    has additional subdomain(s) that are not in the common domain

Details for d2rgna2

PDB Entry: 2rgn (more details), 3.5 Å

PDB Description: crystal structure of p63rhogef complex with galpha-q and rhoa
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(q) subunit alpha

SCOPe Domain Sequences for d2rgna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rgna2 c.37.1.8 (A:38-66,A:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
relkllllgtgesgkstfikqmriihgsgXvpttgiieypfdlqsvifrmvdvggqrser
rkwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfl
nkkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatd
tenirfvfaavkdtilqlnlk

SCOPe Domain Coordinates for d2rgna2:

Click to download the PDB-style file with coordinates for d2rgna2.
(The format of our PDB-style files is described here.)

Timeline for d2rgna2: