Lineage for d2rgnf1 (2rgn F:5-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867847Domain d2rgnf1: 2rgn F:5-180 [152017]
    Other proteins in same PDB: d2rgna1, d2rgna2, d2rgnd1, d2rgnd2
    automatically matched to d1x86b_
    complexed with alf, gdp, mg

Details for d2rgnf1

PDB Entry: 2rgn (more details), 3.5 Å

PDB Description: crystal structure of p63rhogef complex with galpha-q and rhoa
PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d2rgnf1:

Sequence, based on SEQRES records: (download)

>d2rgnf1 c.37.1.8 (F:5-180) RhoA {Human (Homo sapiens) [TaxId: 9606]}
rkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagqe
dydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrnd
ehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

Sequence, based on observed residues (ATOM records): (download)

>d2rgnf1 c.37.1.8 (F:5-180) RhoA {Human (Homo sapiens) [TaxId: 9606]}
rkklvivgdgacgktcllivfskdqfpevyvptvfenyvadelalwdtagqedydrlrpl
sypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrndehtrrela
kmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d2rgnf1:

Click to download the PDB-style file with coordinates for d2rgnf1.
(The format of our PDB-style files is described here.)

Timeline for d2rgnf1: