SCOPe 2.08: Domain d2rgnd2: 2rgn D:38-66,D:184-354

Lineage for d2rgnd2 (2rgn D:38-66,D:184-354)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries)
   Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372

8. Domain d2rgnd2: 2rgn D:38-66,D:184-354 [152016]
   Other proteins in same PDB: d2rgna1, d2rgnc1, d2rgnd1, d2rgnf1
   automatically matched to d2bcjq2
   complexed with alf, gdp, mg
   has additional subdomain(s) that are not in the common domain

Details for d2rgnd2

PDB Entry: 2rgn, 3.5 Å

PDB Description: crystal structure of p63rhogef complex with galpha-q and rhoa

PDB Compounds: (D:) Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(q) subunit alpha

SCOPe Domain Sequences for d2rgnd2:

Sequence; same for both SEQRES and ATOM records:

>d2rgnd2 c.37.1.8 (D:38-66,D:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
relkllllgtgesgkstfikqmriihgsgXvpttgiieypfdlqsvifrmvdvggqrser
rkwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfl
nkkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatd
tenirfvfaavkdtilqlnlk

Timeline for d2rgnd2:

• d2rgnd2 first appeared in SCOP 1.75
  
• d2rgnd2 appears in SCOPe 2.07