SCOPe 2.08: Domain d2r5zb_: 2r5z B:

Lineage for d2r5zb_ (2r5z B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (6 PDB entries)

8. Domain d2r5zb_: 2r5z B: [151598]
   automated match to d1pufb_
   protein/DNA complex

Details for d2r5zb_

PDB Entry: 2r5z, 2.6 Å

PDB Description: structure of scr/exd complex bound to a dna sequence derived from the fkh gene

PDB Compounds: (B:) Homeobox protein extradenticle

SCOPe Domain Sequences for d2r5zb_:

Sequence; same for both SEQRES and ATOM records:

>d2r5zb_ a.4.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkni

Timeline for d2r5zb_:

• d2r5zb_ first appeared in SCOP 1.75, called d2r5zb1
  
• d2r5zb_ appears in SCOPe 2.07