Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (40 proteins) Pfam PF00046 |
Protein Extradenticle (exd) homeodomain [46720] (1 species) |
Species Drosophila melanogaster [TaxId:7227] [46721] (3 PDB entries) |
Domain d2r5zb1: 2r5z B:205-259 [151598] automatically matched to d1b8ib_ |
PDB Entry: 2r5z (more details), 2.6 Å
SCOP Domain Sequences for d2r5zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r5zb1 a.4.1.1 (B:205-259) Extradenticle (exd) homeodomain {Drosophila melanogaster [TaxId: 7227]} rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn
Timeline for d2r5zb1: