SCOP 1.75: Domain d2qexs1: 2qex S:1-81

Lineage for d2qexs1 (2qex S:1-81)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
   Uniprot P12732

8. Domain d2qexs1: 2qex S:1-81 [150707]
   Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
   automatically matched to d1jj2r_
   complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3

Details for d2qexs1

PDB Entry: 2qex, 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d2qexs1:

Sequence; same for both SEQRES and ATOM records:

>d2qexs1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d2qexs1:

• d2qexs1 is new in SCOP 1.75
  
• d2qexs1 appears in SCOPe 2.01
  
• d2qexs1 appears in the current release, SCOPe 2.08