SCOP 1.75: Domain d2qexg1: 2qex G:12-73

Lineage for d2qexg1 (2qex G:12-73)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d2qexg1: 2qex G:12-73 [150695]
   Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
   automatically matched to 1VQ4 G:12-73
   complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3

Details for d2qexg1

PDB Entry: 2qex, 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit

PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d2qexg1:

Sequence, based on SEQRES records:

>d2qexg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d2qexg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d2qexg1:

• d2qexg1 is new in SCOP 1.75
  
• d2qexg1 appears in SCOPe 2.01
  
• d2qexg1 appears in the current release, SCOPe 2.08