Lineage for d2qexw1 (2qex W:1-154)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897374Domain d2qexw1: 2qex W:1-154 [150711]
    Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
    automatically matched to d1w2bv_
    complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3

Details for d2qexw1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOP Domain Sequences for d2qexw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexw1 i.1.1.2 (W:1-154) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d2qexw1:

Click to download the PDB-style file with coordinates for d2qexw1.
(The format of our PDB-style files is described here.)

Timeline for d2qexw1: