Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d2qexw1: 2qex W:1-154 [150711] Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1 automatically matched to d1w2bv_ complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3 |
PDB Entry: 2qex (more details), 2.9 Å
SCOP Domain Sequences for d2qexw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qexw1 i.1.1.2 (W:1-154) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d2qexw1:
View in 3D Domains from other chains: (mouse over for more information) d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexx1, d2qexy1, d2qexz1 |