| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (1 protein) |
| Protein 50S subunit [58125] (6 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d2qexx1: 2qex X:7-88 [150712] Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1 automatically matched to d1w2bw_ complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3 |
PDB Entry: 2qex (more details), 2.9 Å
SCOP Domain Sequences for d2qexx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qexx1 i.1.1.2 (X:7-88) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae
Timeline for d2qexx1:
View in 3DDomains from other chains: (mouse over for more information) d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexy1, d2qexz1 |