Lineage for d2qexc1 (2qex C:1-246)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825407Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 825408Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 825409Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 825410Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 825411Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries)
    Uniprot P12735
  8. 825435Domain d2qexc1: 2qex C:1-246 [150692]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to d1jj2c_
    complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3

Details for d2qexc1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (C:) 50S ribosomal protein L4P

SCOP Domain Sequences for d2qexc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexc1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d2qexc1:

Click to download the PDB-style file with coordinates for d2qexc1.
(The format of our PDB-style files is described here.)

Timeline for d2qexc1: