| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix |
| Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
| Protein Ribosomal protein L39e [48664] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
| Domain d2qex21: 2qex 2:1-49 [150689] Other proteins in same PDB: d2qex11, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1 automatically matched to 1VQ4 2:1-49 complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3 |
PDB Entry: 2qex (more details), 2.9 Å
SCOP Domain Sequences for d2qex21:
Sequence, based on SEQRES records: (download)
>d2qex21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d2qex21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d2qex21:
View in 3DDomains from other chains: (mouse over for more information) d2qex11, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1 |