SCOP 1.75: Domain d2qex11: 2qex 1:1-56

Lineage for d2qex11 (2qex 1:1-56)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d2qex11: 2qex 1:1-56 [150688]
   Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
   automatically matched to d1w2bz_
   complexed with 1ma, cd, cl, k, mg, na, neg, omg, omu, psu, ur3

Details for d2qex11

PDB Entry: 2qex, 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit

PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d2qex11:

Sequence; same for both SEQRES and ATOM records:

>d2qex11 i.1.1.2 (1:1-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d2qex11:

• d2qex11 is new in SCOP 1.75
  
• d2qex11 appears in SCOPe 2.01
  
• d2qex11 appears in the current release, SCOPe 2.08