Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Family d.344.1.3: SLD5 C-terminal domain-like [160068] (1 protein) C-terminal part of Pfam PF05916 |
Protein GINS complex subunit 4, SLD5 [160069] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160070] (2 PDB entries) Uniprot Q9BRT9 166-223 |
Domain d2e9xh2: 2e9x H:166-223 [146752] Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xd1, d2e9xe_, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh1 automated match to d2e9xd2 protein/DNA complex; complexed with so4 |
PDB Entry: 2e9x (more details), 2.3 Å
SCOPe Domain Sequences for d2e9xh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e9xh2 d.344.1.3 (H:166-223) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]} dldsyvflrvrerqenilvepdtdeqrdyvidlekgsqhliryktiaplvasgavqli
Timeline for d2e9xh2: