![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
![]() | Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) ![]() associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
![]() | Family d.344.1.0: automated matches [254227] (1 protein) not a true family |
![]() | Protein automated matches [254515] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries) |
![]() | Domain d2e9xb2: 2e9x B:1-61 [146741] Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xc1, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2 automated match to d2e9xb2 protein/DNA complex; complexed with so4 |
PDB Entry: 2e9x (more details), 2.3 Å
SCOPe Domain Sequences for d2e9xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e9xb2 d.344.1.0 (B:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl l
Timeline for d2e9xb2: