SCOP 1.75: Domain d2e9xb2: 2e9x B:1-61

Lineage for d2e9xb2 (2e9x B:1-61)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold ((64243))
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold (64243))

4. Superfamily d.344.1: PriA/YqbF domain [160059] (4 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.2: PSF2 N-terminal domain-like [160065] (1 protein)
   N-terminal part of Pfam PF04128

6. Protein DNA replication complex GINS protein PSF2 [160066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160067] (3 PDB entries)
   Uniprot Q9Y248 1-61

8. Domain d2e9xb2: 2e9x B:1-61 [146741]
   Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xc1, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xe1, d2e9xf1, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2
   automatically matched to 2EHO C:1-61
   complexed with so4

Details for d2e9xb2

PDB Entry: 2e9x, 2.3 Å

PDB Description: the crystal structure of human gins core complex

PDB Compounds: (B:) DNA replication complex GINS protein PSF2

SCOP Domain Sequences for d2e9xb2:

Sequence; same for both SEQRES and ATOM records:

>d2e9xb2 d.344.1.2 (B:1-61) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

Timeline for d2e9xb2:

• d2e9xb2 is new in SCOP 1.75
  
• d2e9xb2 appears in SCOPe 2.01
  
• d2e9xb2 appears in the current release, SCOPe 2.08