Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein) N-terminal part of Pfam PF06425 |
Protein GINS complex subunit 3, PSF3 [160072] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries) Uniprot Q9BRX5 1-87 |
Domain d2e9xg2: 2e9x G:1-87 [146750] Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xh1, d2e9xh2 automated match to d2e9xc2 protein/DNA complex; complexed with so4 |
PDB Entry: 2e9x (more details), 2.3 Å
SCOPe Domain Sequences for d2e9xg2:
Sequence, based on SEQRES records: (download)
>d2e9xg2 d.344.1.4 (G:1-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnav pqgsklelplwlakglfdnkrrilsve
>d2e9xg2 d.344.1.4 (G:1-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffdnavpqgsklelp lwlakglfdnkrrilsve
Timeline for d2e9xg2: