![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
![]() | Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) ![]() common to all subunits of the GINS complex |
![]() | Family a.278.1.3: PSF3 C-terminal domain-like [158580] (1 protein) C-terminal part of Pfam PF06425 |
![]() | Protein GINS complex subunit 3, PSF3 [158581] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158582] (3 PDB entries) Uniprot Q9BRX5 88-92 |
![]() | Domain d2e9xg1: 2e9x G:88-192 [146749] Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xf2, d2e9xg2, d2e9xh1, d2e9xh2 automated match to d2e9xc1 protein/DNA complex; complexed with so4 |
PDB Entry: 2e9x (more details), 2.3 Å
SCOPe Domain Sequences for d2e9xg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e9xg1 a.278.1.3 (G:88-192) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} lpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspenadisqsllqtfigrfr rimdssqnaynedtsalvarldemerglfqtgqkglndfqcwekg
Timeline for d2e9xg1: