SCOPe 2.04: Domain d2e9xg1: 2e9x G:88-192

Lineage for d2e9xg1 (2e9x G:88-192)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.3: PSF3 C-terminal domain-like [158580] (1 protein)
   C-terminal part of Pfam PF06425

6. Protein GINS complex subunit 3, PSF3 [158581] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158582] (3 PDB entries)
   Uniprot Q9BRX5 88-92

8. Domain d2e9xg1: 2e9x G:88-192 [146749]
   Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xf2, d2e9xg2, d2e9xh1, d2e9xh2
   automated match to d2e9xc1
   protein/DNA complex; complexed with so4

Details for d2e9xg1

PDB Entry: 2e9x, 2.3 Å

PDB Description: the crystal structure of human gins core complex

PDB Compounds: (G:) GINS complex subunit 3

SCOPe Domain Sequences for d2e9xg1:

Sequence; same for both SEQRES and ATOM records:

>d2e9xg1 a.278.1.3 (G:88-192) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
lpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspenadisqsllqtfigrfr
rimdssqnaynedtsalvarldemerglfqtgqkglndfqcwekg

Timeline for d2e9xg1:

• d2e9xg1 first appeared in SCOP 1.75
  
• d2e9xg1 appears in SCOPe 2.03
  
• d2e9xg1 appears in SCOPe 2.05
  
• d2e9xg1 appears in the current release, SCOPe 2.08