Class a: All alpha proteins [46456] (285 folds) |
Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) common to all subunits of the GINS complex |
Family a.278.1.1: PSF1 N-terminal domain-like [158574] (2 proteins) |
Protein DNA replication complex GINS protein PSF1 [158575] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158576] (2 PDB entries) Uniprot Q14691 1-144! Uniprot Q14691 1-145 |
Domain d2e9xa1: 2e9x A:1-144 [146739] Other proteins in same PDB: d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2 protein/DNA complex; complexed with so4 |
PDB Entry: 2e9x (more details), 2.3 Å
SCOPe Domain Sequences for d2e9xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e9xa1 a.278.1.1 (A:1-144) DNA replication complex GINS protein PSF1 {Human (Homo sapiens) [TaxId: 9606]} mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip tikfrhcsllrnrrctvaylydrllriralrweygsvlpnalrfhmaaeemewfnnykrs latymrslggdeglditqdmkppk
Timeline for d2e9xa1: