Lineage for d2e9xh2 (2e9x H:166-223)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567330Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 2567331Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 2567343Family d.344.1.3: SLD5 C-terminal domain-like [160068] (1 protein)
    C-terminal part of Pfam PF05916
  6. 2567344Protein GINS complex subunit 4, SLD5 [160069] (1 species)
  7. 2567345Species Human (Homo sapiens) [TaxId:9606] [160070] (2 PDB entries)
    Uniprot Q9BRT9 166-223
  8. 2567349Domain d2e9xh2: 2e9x H:166-223 [146752]
    Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xc3, d2e9xd1, d2e9xe_, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh1
    automated match to d2e9xd2
    protein/DNA complex; complexed with so4

Details for d2e9xh2

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (H:) GINS complex subunit 4

SCOPe Domain Sequences for d2e9xh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9xh2 d.344.1.3 (H:166-223) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
dldsyvflrvrerqenilvepdtdeqrdyvidlekgsqhliryktiaplvasgavqli

SCOPe Domain Coordinates for d2e9xh2:

Click to download the PDB-style file with coordinates for d2e9xh2.
(The format of our PDB-style files is described here.)

Timeline for d2e9xh2: