SCOPe 2.08: Domain d2c39g2: 2c39 G:192-275

Lineage for d2c39g2 (2c39 G:192-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)

6. Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries)
   Uniprot Q9UXC0 192-275

8. Domain d2c39g2: 2c39 G:192-275 [146337]
   Other proteins in same PDB: d2c39a1, d2c39b1, d2c39b2, d2c39c1, d2c39d1, d2c39d2, d2c39e1, d2c39f1, d2c39f2, d2c39g1, d2c39i1, d2c39j1, d2c39j2, d2c39k1, d2c39l1, d2c39l2, d2c39m1, d2c39n1, d2c39n2, d2c39o1, d2c39p1, d2c39p2, d2c39q1, d2c39r1, d2c39r2, d2c39s1, d2c39t1, d2c39t2, d2c39u1, d2c39v1, d2c39v2, d2c39w1, d2c39x1, d2c39x2
   automatically matched to 2JE6 A:192-275
   protein/RNA complex; complexed with adp

Details for d2c39g2

PDB Entry: 2c39, 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp

PDB Compounds: (G:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c39g2:

Sequence; same for both SEQRES and ATOM records:

>d2c39g2 d.101.1.1 (G:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

Timeline for d2c39g2:

• d2c39g2 first appeared in SCOP 1.75
  
• d2c39g2 appears in SCOPe 2.07